PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn072001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family BES1
Protein Properties Length: 744aa    MW: 83486.3 Da    PI: 5.7601
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn072001genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822131.31.1e-40742142133
      DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyr....kgskpl.eeaeaagssas...aspes 92 
                 g +r ++ +E+E++k RER+RRa++aki+aGLR++Gny+l++raD+n+V++AL+reAGwvv +DGtt++    +g +p   ++++  +sas     +++
  Achn072001  74 GVRRCRPVEEKERTKIRERQRRAVTAKILAGLRRHGNYNLRVRADINDVIAALAREAGWVVLPDGTTFPstssQGIRPAgGTSSTPLTSASshvPMQQN 172
                 6789999*************************************************************9666667777763333332222222233333 PP

      DUF822  93 slq.sslkssalaspvesysaspksssfpspssldsislasa 133
                 ++  ++   s  +s ve  ++++k + +p  s +d  s++ +
  Achn072001 173 PSAsLRGICSGNKSSVEYNACRMKGVFVPTLSPYDVSSSSRS 214
                 333366677888899999999999999999999988876644 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056876.6E-3676205IPR008540BES1/BZR1 plant transcription factor, N-terminal
SuperFamilySSF514453.67E-181259700IPR017853Glycoside hydrolase superfamily
Gene3DG3DSA:3.20.20.807.8E-199260694IPR013781Glycoside hydrolase, catalytic domain
PfamPF013738.1E-103266686IPR001554Glycoside hydrolase, family 14
PRINTSPR007508.6E-69297311IPR001554Glycoside hydrolase, family 14
PRINTSPR007508.6E-69318336IPR001554Glycoside hydrolase, family 14
PRINTSPR007508.6E-69340361IPR001554Glycoside hydrolase, family 14
PRINTSPR008423.1E-8423432IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR007508.6E-69433455IPR001554Glycoside hydrolase, family 14
PRINTSPR007508.6E-69506525IPR001554Glycoside hydrolase, family 14
PRINTSPR007508.6E-69540556IPR001554Glycoside hydrolase, family 14
PRINTSPR007508.6E-69557568IPR001554Glycoside hydrolase, family 14
PRINTSPR007508.6E-69575598IPR001554Glycoside hydrolase, family 14
PRINTSPR008423.1E-8578588IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR007508.6E-69615637IPR001554Glycoside hydrolase, family 14
PRINTSPR008423.1E-8666680IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR008423.1E-8681695IPR001371Glycoside hydrolase, family 14B, plant
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000272Biological Processpolysaccharide catabolic process
GO:0048831Biological Processregulation of shoot system development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016161Molecular Functionbeta-amylase activity
Sequence ? help Back to Top
Protein Sequence    Length: 744 aa     Download sequence    Send to blast
MTTEMQRFGT SEEDDEDMGM DVKEEDDDDD DDDDEKNNGT PIMVGVDGGL ASSSNNNRFQ  60
QQQQYQDQPT PQAGVRRCRP VEEKERTKIR ERQRRAVTAK ILAGLRRHGN YNLRVRADIN  120
DVIAALAREA GWVVLPDGTT FPSTSSQGIR PAGGTSSTPL TSASSHVPMQ QNPSASLRGI  180
CSGNKSSVEY NACRMKGVFV PTLSPYDVSS SSRSQTEAMV VAGGDGAENY PLIGGSMDTV  240
DNRQVIDIPQ KLQERDLAGT PYVPVYLMLP LGVINMKCEL VDPDGLVKQL RILKSINVDG  300
VMVDCWWGIV EAHTPQDYNW NGYKRLFQMV RELKLKLQVV LSFHECGGNI GDDVCIPLPQ  360
WVAEIGRSNP DIFFTDREGR RNPECLSWGI DKERVLRGRT AVEVYFDYMR SFRVEFDEFF  420
EDGIISIIEV GLGPCGELRY PSNPVKHGWR YPGVGEFQCY DQYLLKNLRK AAEARGHSFW  480
ARGPDNAGSY NSQPHETGFF CDGGDYDGYY GRFFLNWYSK VLVDHGDRVL TLAKLAFEGT  540
CIAVKLSGIY WWYKTASHAA ELTAGFYNPC NRDGYAAIMA MLKKHGAALN FMCAECGLLD  600
QHVDFPGALA DPEGLAWQVL NAAWDVCIPV ASENALPCHD REGYNNISER AKPLNDPDGR  660
HFCGFTYLRL GTVLLERHNF MEFERFVKRM HGNMLETFRN LYLYSYSLVI WFGCKGNNQP  720
GGHTSNLMNL NKIRILKLII KHV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1uko_A1e-15226269311444Beta-amylase
1uko_B1e-15226269311444Beta-amylase
1uko_C1e-15226269311444Beta-amylase
1uko_D1e-15226269311444Beta-amylase
1wdq_A1e-15226269311444Beta-amylase
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP7394630.0KP739463.1 Camellia sinensis beta-amylase 7 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002273843.10.0PREDICTED: beta-amylase 7
SwissprotO808310.0BAM7_ARATH; Beta-amylase 7
TrEMBLA0A0K0PUB30.0A0A0K0PUB3_CAMSI; Beta-amylase
STRINGVIT_15s0046g02640.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16072448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45880.10.0beta-amylase 7